SBP day

from Wikipedia, the free encyclopedia

The SBP tag (from English Streptavidin binding peptide tag ) is a protein tag that is used in biochemistry for protein purification and detection.

properties

The SBP tag is used, among other things, for affinity chromatography and pulldown assays . It has the amino acid sequence MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The SBP tag was generated by mRNA display . The selection was carried out at high throughput with incubation of a peptide library with streptavidin agarose and elution with biotin . The SBP tag binds to streptavidin with a dissociation constant of 2.5  nM . Elution takes place by adding biotin under native conditions.

Applications

The SBP tag is used, among other things, as one of the two separation steps in the course of a tandem affinity purification .

Individual evidence

  1. ↑ a b c David S. Wilson, Anthony D. Keefe, Jack W. Szostak: The use of mRNA display to select high-affinity protein-binding peptides . In: Proceedings of the National Academy of Sciences . 98, No. 7, 2001, pp. 3750-5. doi : 10.1073 / pnas.061028198 . PMID 11274392 . PMC 31124 (free full text).
  2. ^ A b Anthony D. Keefe, David S. Wilson, Burckhard Seelig, Jack W. Szostak: One-Step Purification of Recombinant Proteins Using a Nanomolar-Affinity Streptavidin-Binding Peptide, the SBP-Tag . In: Protein Expression and Purification . 23, No. 3, 2001, pp. 440-6. doi : 10.1006 / prep.2001.1515 . PMID 11722181 .
  3. ↑ Jelle Van Leene, Dominique Eeckhout, Geert Persiau, Eveline Van De Slijke, Jan Geerinck, Gert Van Isterdael, Erwin Witters, Geert De Jaeger: Plant Transcription Factors . Ed .: Ling Yuan, Sharyn E. Perry (=  Methods in Molecular Biology . Volume 754 , no. 4 ). 2011, ISBN 978-1-61779-153-6 , Isolation of Transcription Factor Complexes from Arabidopsis Cell Suspension Cultures by Tandem Affinity Purification, p. 195-218 , doi : 10.1007 / 978-1-61779-154-3_11 , PMID 21720954 .
  4. ↑ Azlinda Anwar, KM Leong, Mary L. Ng, Justin JH Chu, Mariano A. Garcia-Blanco: The Polypyrimidine Tract-binding Protein Is Required for Efficient Dengue Virus Propagation and Associates with the Viral Replication Machinery . In: Journal of Biological Chemistry . 284, No. 25, 2009, pp. 17021-9. doi : 10.1074 / jbc.M109.006239 . PMID 19380576 . PMC 2719340 (free full text).