Teduglutid

from Wikipedia, the free encyclopedia
Structural formula
Structural formula of teduglutide
General
Non-proprietary name Teduglutid
other names
  • [Gly 2 ] - GLP-2
  • His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
  • HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Molecular formula C 164 H 252 N 44 O 55 S.
Brief description

White dust

External identifiers / databases
CAS number 197922-42-2
PubChem 16139605
ChemSpider 17296109
DrugBank DB08900
Wikidata Q7694156
Drug information
ATC code

A16 AX08

properties
Molar mass 3752.08 g mol −1
safety instructions
Please note the exemption from the labeling requirement for drugs, medical devices, cosmetics, food and animal feed
GHS hazard labeling
no classification available
As far as possible and customary, SI units are used. Unless otherwise noted, the data given apply to standard conditions .

Teduglutide is a drug from the group of hormone analogues that is used in the treatment of short bowel syndrome. It is an analogue of the peptide hormone Glucagon-like Peptide -2 (GLP-2), a hormone that is produced by enteroendocrine cells in the human intestine . It is produced in Escherichia coli cells using the recombinant DNA method.

Clinical information

Application areas (indications)

Teduglutide is indicated for the treatment of adults with short bowel syndrome . It can improve the restricted nutrient and fluid intake in the remaining part of the intestine and thus reduce the dependence on parenteral nutrition and fluid intake.

Type and duration of application

The injection is given subcutaneously once a day into the abdomen or thighs, the injection site must be cleaned beforehand. The effect of the treatment should be assessed after six months. The therapy takes place under the supervision of a specialist doctor or a qualified medical professional. A colonoscopy should be performed before use to determine whether intestinal polyps are present and to remove them if necessary.

Contraindications (contraindications)

Teduglutide is contraindicated in case of hypersensitivity to the active ingredient, other components of the drug or tetracycline. In addition, it should not be used in the case of active cancer or suspected cancer, as well as a malignant disease of the gastrointestinal tract that occurred up to 5 years before.

Adverse effects (side effects)

The most common side effects observed were abdominal pain and gas, respiratory infections, nausea, injection site reactions, headache, vomiting, and peripheral edema.

Pharmacological properties

Mechanism of action (pharmacodynamics)

Teduglutide increases the villi height in the small intestine, causing the absorbent intestinal epithelium to expand. It increases blood flow in and out of the intestines and reduces the speed at which food travels through the intestines. Teduglutide also inhibits the production of stomach acid.

literature

  • Jeppesen PB, Pertkiewicz M, Messing B, et al. Teduglutide reduces need for parenteral support among patients with short bowel syndrome with intestinal failure. Gastroenterology 2012; 143 (6): 1473-1481
  • Black L, O'Keefe S, Jeppessen PB, et al. Long-term safety and efficacy of teduglutide for the treatment of intestinal failure associated with short bowel syndrome: Final results of the STEPS-2 study, a 2-year, multicenter, open-label clinical trial. Poster presented at the American College of Gastroenterology 2013 Annual Scientific Meeting October 11-16, 2013; San Diego. CA

Individual evidence

  1. ↑ FDA: GATTEX (teduglutide) , accessed March 1, 2015
  2. ↑ This substance has either not yet been classified with regard to its hazardousness or a reliable and citable source has not yet been found.
  3. ↑ a b c d e Summary of the product characteristics from the website of the European Health Authority (EMA), http://www.ema.europa.eu/docs/de_DE/document_library/EPAR_-_Product_Information/human/002345/WC500132926.pdf
  4. ↑ a b Jeppesen PB, Pertkiewicz M, Messing B, et al. Teduglutide reduces need for parenteral support among patients with short bowel syndrome with intestinal failure. Gastroenterology 2012; 143 (6): 1473-1481.
  5. ↑ a b Schwarz L, O'Keefe S, Jeppessen PB, et al. Long-term safety and efficacy of teduglutide for the treatment of intestinal failure associated with short bowel syndrome: Final results of the STEPS-2 study, a 2-year, multicenter, open-label clinical trial. Poster presented at the American College of Gastroenterology 2013 Annual Scientific Meeting October 11-16, 2013; San Diego. Approx.
  6. ↑ a b c Pharmazeutische Zeitung: Five newcomers in September, http://www.pharmazeutische-zeitung.de/index.php?id=54450 .
  7. ↑ Public Assessment Report (EPAR) of the European Medicines Agency (EMA) on: Revestive, http://www.ema.europa.eu/docs/en_GB/document_library/EPAR_-_Summary_for_the_public/human/002345/WC500132929.pdf

Trade names

Revestive (EU), Gattex (USA)